PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g026490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MYB
Protein Properties Length: 1655aa    MW: 181171 Da    PI: 6.9436
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g026490.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.55.7e-12879920346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e++++  +++G++ +k+Ia+++   +t  +c+++++k
   Csa06g026490.1 879 PWTSEEKEIFLKMLALHGKD-FKKIASYLK-QKTTADCIDYYYK 920
                      8*****************99.********9.9**********98 PP

2Myb_DNA-binding27.19.8e-0910941135447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       WT +E   +++++ ++G++ +++I+r++g  R++ qc+ ++ k+
   Csa06g026490.1 1094 WTDDERSAFIQGFSLFGKN-FASISRYVG-SRSPDQCRVFFSKV 1135
                       *****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.43E-15862923IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-7871922IPR009057Homeodomain-like
PROSITE profilePS5129315.717875926IPR017884SANT domain
SMARTSM007171.3E-10876924IPR001005SANT/Myb domain
PfamPF002497.6E-10878920IPR001005SANT/Myb domain
CDDcd001676.54E-9879921No hitNo description
PROSITE profilePS5129312.510891140IPR017884SANT domain
SMARTSM007176.0E-810901138IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-410931134IPR009057Homeodomain-like
SuperFamilySSF466892.42E-910931140IPR009057Homeodomain-like
CDDcd001679.08E-710941135No hitNo description
PfamPF002494.0E-710941134IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1655 aa     Download sequence    Send to blast
MPQDHASWDR KELLRQRKHD RPEPSSFDSP FRWRDSPSST PSSHHVPREF SRWGSGDFRR  60
PSSSSSSSCH GKQGGRHQFA EESSHGYTSS RSSARIFDND YYRPSASRGD WRYTRNCRDD  120
RVSVSQKEWK CNTWEMSNGS SRSFERPFGI RNGRRSVDER PLHASDTHTT AVNSFDPTNS  180
AHQPDPMAYT PVRSLKFKSE QKFSDQRLSL PSDPHSDCVS LFERPSSENN YGNKVCSPAK  240
QCNDLMYGRR IANDNSLDPP ILNAELEGSW EQPHLKDPQE DNRLHGISDL DGARKCAKES  300
ALGAIGKLPL WNSSGSFASQ SSGFSHSSSL KSLGAVDSSD RKTEALPKTV TVTQSSSGDA  360
TACATTTHLS EEMSSRKKQR LGWGEGLAKY EKKRVDVNTN EDGTTLLENG SEELHSLNKN  420
IADKSPTAAT VPDYGSPTTP SSVACSSSPG FADKSSAKAA IAGCDVSDMC RSPSPVSSFH  480
LEQFPINIEE LDNILMERFG CLLNELLCTD DPGTGDSSSV QLTSMNRLLS WKSEILKAVE  540
MTESEIDLLE NKHRALKLEG ERHCHVVGPS SHFCEGDANV PKEKEASCIL GPKVAAPSVA  600
ETLVRSPVHQ SGLAKVPVDV FEDNPGEVKS LSQSFATVES NEDLLPMTSM KAAASSKEIN  660
TPAFVSQETI ELSAAADSMA SNEDLLCATL YSSNKKYACE SSGVFNELLP RNFCSFDDSR  720
FPSICQTQFD SHVKEKIADR VELLRAREKI LLLQFKAFQL SWKKDLHQLA STKYQSKSSK  780
KTELYPNAKN GGYLKLPQPV RLRFSSSAPR RDSVVPTTEL VSYMEKLLPG THLKPIRDIL  840
RMPAMILDEK ERVMSRFISS NGLVEDPCDV EKERTMINPW TSEEKEIFLK MLALHGKDFK  900
KIASYLKQKT TADCIDYYYK NHKSDCFGKI KKQRAYGKEG KHTYMLAPRK KWKREMGAAS  960
LDLLGAVSVV AANAGKDAPT RPITSKRITL RGCSSSNSLQ HDGNNSEGCS YSFDFPRKRT  1020
VGADVLAVGP LSSEQINSCL RTSVSSRERC MDHLKFNPVV KKPRISHTLH NENSNEEDDS  1080
CSEESCGETG PIHWTDDERS AFIQGFSLFG KNFASISRYV GSRSPDQCRV FFSKVRKCLG  1140
LEFIQSGSGN VSTSVSVDNG NEGGGSDLED PCPIESNSGI CTKMDMNSPT SPFNMNQDGA  1200
NHSGSANVKA DLSRSEQENG LTYMQDGSNP VNNAYINGGL PGLISESCRD LVDINTVESQ  1260
SQAAGKSKSN DLLSMEIDEG VLTSVAVYSE PLYCGLSVLS NVIVETPAES SRKGSGDQGS  1320
AIPKLSSKNQ DGVMQAANKT KNSGLEPESA PSGFKYPECL HHVPIEVCTE NPIGVSVRRG  1380
NPNCHTEGKS GHSLVGQAVE THDLGWQSSK DNLEFDRQLQ VIGDVNPEQN GHLNANYAES  1440
CQIPQRSVIQ VPSRISRSKS DLIVKAQRTG EGFSLNKCTS SAPNPLAVSH KEGRSGHSRS  1500
HSFSLSDTER LDKNGDVKLF GTVLTADENG IKQKHNPCGS VRSSSTLSRD HDTRHHCINQ  1560
QHLQNVPITS YGFWDGNRIQ TGLTSLPESA KLLASCPEAF SSHLKQQVGK EIRLDVNGGG  1620
ILSFGKLNED RAEASSAKDG GNIGGVNGVA EAAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C3e-16836927393NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D3e-16836927393NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF5469830.0HF546983.1 Arabis alpina myb gene for myb like transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010515683.10.0PREDICTED: uncharacterized protein LOC104791478
RefseqXP_010515684.10.0PREDICTED: uncharacterized protein LOC104791478
TrEMBLD7LU400.0D7LU40_ARALL; Myb family transcription factor
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein